Rhox11 Rabbit Polyclonal Antibody TA331440 from OriGene Technologies | Biocompare.com

Supplier Images

Rhox11 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rhox11 Rabbit Polyclonal Antibody

The Rhox11 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to reproductive homeobox 11, and Rhox11. This antibody recognizes Mouse antigen. The Rhox11 Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit polyclonal Anti-RHOX11 Antibody

Product Specs
ItemRhox11 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA331440
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetRHOX11
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11. Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV
NCBI Full Gene Namereproductive homeobox 11
NCBI Gene AliasesGm39, BC049711
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!